PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G227500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 298aa    MW: 32690.8 Da    PI: 6.7961
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G227500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.82.1e-073276244
                        SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                        g+WT+eE +l+ +a ++   +   +W+++a++++ gR   +++ ++
  Sevir.3G227500.1.p 32 GAWTQEENKLFERALARVDWDapdRWERVAAMLP-GRMVPDVVAHF 76
                        79****************99999***********.***99999997 PP

2Myb_DNA-binding45.81.4e-14143187347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + k++G g+W+ I+r + + Rt+ q+ s+ qky
  Sevir.3G227500.1.p 143 PWTEEEHKLFLMGLKKYGRGDWRNISRNFVTSRTPTQVASHAQKY 187
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007176.4E-53082IPR001005SANT/Myb domain
PfamPF002496.9E-63276IPR001005SANT/Myb domain
PROSITE profilePS500906.263267IPR017877Myb-like domain
SuperFamilySSF466896.56E-103287IPR009057Homeodomain-like
CDDcd001678.60E-63376No hitNo description
PROSITE profilePS5129417.568136192IPR017930Myb domain
SuperFamilySSF466891.35E-17138192IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-17139190IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.9E-12140186IPR009057Homeodomain-like
SMARTSM007175.8E-13140190IPR001005SANT/Myb domain
PfamPF002496.8E-12143187IPR001005SANT/Myb domain
CDDcd001671.74E-11143188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MMESWMEVLP PPYFAGQAAG RFLPDRRAPG PGAWTQEENK LFERALARVD WDAPDRWERV  60
AAMLPGRMVP DVVAHFDDLE NDVCFIEAGL LPFPQYGGGA AQNAGFTFDW DGDAGGLGFK  120
RSCYMVAGKR GRGPDQERKK GVPWTEEEHK LFLMGLKKYG RGDWRNISRN FVTSRTPTQV  180
ASHAQKYFIR LNSGGKDKRR SSIHDITTVN LPDDDGGNPS PSPPSVLTSA STPSSTGGPV  240
ISEQFGVLVD SKLPPSHHFM PHPYGNVKLE PGNSHHGGFL DDSVLMQMQC GQLQPLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1334961173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542810.0BT054281.1 Zea mays full-length cDNA clone ZM_BFb0211P03 mRNA, complete cds.
GenBankBT0558020.0BT055802.1 Zea mays full-length cDNA clone ZM_BFb0203M07 mRNA, complete cds.
GenBankBT0666720.0BT066672.1 Zea mays full-length cDNA clone ZM_BFb0049J12 mRNA, complete cds.
GenBankHQ8587850.0HQ858785.1 Zea mays clone UT1771 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961904.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H75e-78DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3Z8E60.0K3Z8E6_SETIT; Uncharacterized protein
STRINGSi022816m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-78MYB family protein